#HOT PRODUCT

[AlexoTech 한국공식대리점] Amyloid-Beta 1-40 (0.5 mg) Human, Recombinant

등록일2025. 11. 25
조회수161
링크 복사하기
[AlexoTech 한국공식대리점] Amyloid-Beta 1-40 (0.5 mg) Human, Recombinant

[AlexoTech 한국공식대리점] Amyloid-Beta 1-40 (0.5 mg) Human, Recombinant


어스바이오는 AlexoTech 한국 공식 대리점으로서 모든 제품을 전문적으로 취급 및 공급하고 있습니다.
AlexoTech의 Amyloid-Beta 제품을 소개드립니다.
 

[Amyloid-Beta 1-40 (0.5 mg) Human, Recombinant]


Amyloid-Beta 1-40 (0.5 mg) Human, Recombinant


Product Description:

  • Article no.: AB-100-05
  • Description: Recombinant Amyloid-Beta-peptide 1-40
  • Amount: 0.5mg
  • Format: Lyophilized
  • Molecular Weight: 4330 Da
  • Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • Purity: 95% by Chromatography and SDS-PAGE
  • Counter Ion: Ammonium Acetate
  • Storage: Store at -20°C upon arrival.
  • Source: Protein expressed in Escherichia coli.


Solubility:

Alexotech has developed a proprietary technique of preparing the Amyloid β-peptide (1-40) having a superior solubility. It is however, of utmost importance to follow our recommendations of solubilisation: To efficiently solubilise the Amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice.


Product Citations:

Lindberg, D. J., Wranne, M. S., Gilbert Gatty, M., Westerlund, F., & Esbjörner, E. K. (2015). Steady-state and time-resolved Thioflavin-T fluorescence can report on morphological differences in amyloid fibrils formed by Aβ(1-40) and Aβ(1-42). Biochemical and Biophysical Research Communications, 458(2), 418–423. https://doi.org/10.1016/j.bbrc.2015.01.132 

Horowitz, S., Koepnick, B., Martin, R., Tymieniecki, A., Winburn, A. A., Cooper, S., … Bardwell, J. C. (2016). Determining crystal structures through crowdsourcing and coursework. Nature communications, 7, 12549. doi:10.1038/ncomms12549

Luo, J., Wärmländer, S. K., Gräslund, A., & Abrahams, J. P. (2014). Non-chaperone proteins can inhibit aggregation and cytotoxicity of Alzheimer amyloid β peptide. The Journal of biological chemistry, 289(40), 27766–27775. doi:10.1074/jbc.M114.574947

Lu, J.-X., Qiang, W., Yau, W.-M., Schwieters, C. D., Meredith, S. C., & Tycko, R. (2013). Molecular Structure of β-Amyloid Fibrils in Alzheimer’s Disease Brain Tissue. Cell, 154(6), 1257–1268. https://doi.org/10.1016/j.cell.2013.08.035

Schultz, N., Brännström, K., Byman, E., Moussaud, S., Nielsen, H. M., … Olofsson, A. (2018). Amyloid-beta 1-40 is associated with alterations in NG2+ pericyte population ex vivo and in vitro. Aging Cell, 17(3), e12728. https://doi.org/10.1111/acel.12728
 


어스바이오(USBIO)는 AlexoTech 한국 공식 대리점입니다.
해당 제품에 대한 문의나 AlexoTech 제품의 견적 또는 문의사항이 있으시면 아래로 연락주시기 바랍니다.
Tel : 02-862-2816 / email : bio@usbio.co.kr
관련 포스트